PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024446-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 335aa    MW: 37178.5 Da    PI: 7.2241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024446-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++++G+++W++I++  g+ R++k+c++rw +yl
    NNU_024446-RA 14 RGQWTPEEDNKLSSYIARHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding476e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++ E++ +v+++   G++ W++Ia+ ++ gRt++++k++w++
    NNU_024446-RA  68 GEFSESEEQTIVKLHSVVGNR-WSLIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.262965IPR017930Myb domain
SuperFamilySSF466892.51E-2911108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-171461IPR001005SANT/Myb domain
CDDcd001673.21E-121761No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129420.63266116IPR017930Myb domain
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002491.9E-1368110IPR001005SANT/Myb domain
CDDcd001678.63E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLSSYIA RHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF SESEEQTIVK LHSVVGNRWS LIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL PPPQVAHLAE AALGCFKDEM LHLLTKKRID FQLQRSSSTP  180
GYDVPQPAGV NTAATFVTGR TEDKDDXIQK IKLGVSRAMQ EPDALPTNKP WTITSTGETS  240
DGFARDRNTF PVKISGFQYG PPSYGNEGDG SAWSQSMCTG STCTGGDQQG RLHEKAEEED  300
GEEAEGGKAA RKESSMFNSD CVLWDLSDDL MNPIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244825.10.0PREDICTED: transcription factor MYB28
SwissprotQ7XQN11e-127MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A0G2R0N20.0A0A0G2R0N2_VITVI; Transcription repressor MYB4
TrEMBLD7UAP50.0D7UAP5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g01280.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-118myb domain protein 103